PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI09G12650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 851aa    MW: 89925.2 Da    PI: 5.9305
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI09G12650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.32e-21105160156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  OMERI09G12650.1 105 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 160
                      688999***********************************************999 PP

2START177.21e-553305601205
                      HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
            START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                      ela++a++elvk a+ +ep+W  s     e +n+de+ + f++  +     + +ea r+sg+ +  +++lv +l+d + +W+e+++    +a+t
  OMERI09G12650.1 330 ELALAAMDELVKVAQMDEPLWLPSLdggfETLNYDEYHRAFARVLGqcpagYVSEATRESGIAIISSVDLVDSLMDAP-RWSEMFPcvvaRAST 422
                      5899*************************************8866699******************************.*************** PP

                      EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--........-TTSEE-EESSEEEEEEEECTCE CS
            START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.......sssvvRaellpSgiliepksngh 161
                      ++ issg      g +qlm aelq+lsplvp R++vf+R+++q+ +g w++vdvSvd    p +       sss++ ++llp+g++++++ ng+
  OMERI09G12650.1 423 TDIISSGmggtrsGSIQLMHAELQVLSPLVPiREVVFLRFCKQHAEGLWAVVDVSVDAVLRPDQngcggssSSSYMGCRLLPTGCIVQDMNNGY 516
                      *********************************************************988887667778889********************** PP

                      EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
            START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                      skvtwv h+++++   h+l+r+l++sg+a ga++w+a lqrqc+
  OMERI09G12650.1 517 SKVTWVVHAEYDETAAHQLYRPLLRSGQALGARRWLASLQRQCQ 560
                      *******************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.01E-2287162IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-2392162IPR009057Homeodomain-like
PROSITE profilePS5007118.301102162IPR001356Homeobox domain
SMARTSM003891.5E-19103166IPR001356Homeobox domain
PfamPF000466.3E-19105160IPR001356Homeobox domain
CDDcd000861.00E-19105162No hitNo description
PROSITE patternPS000270137160IPR017970Homeobox, conserved site
PROSITE profilePS5084841.584321564IPR002913START domain
SuperFamilySSF559617.8E-30325560No hitNo description
PfamPF018524.9E-47330560IPR002913START domain
SMARTSM002342.6E-40330561IPR002913START domain
CDDcd088753.99E-99336560No hitNo description
SuperFamilySSF559613.19E-14580833No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 851 aa     Download sequence    Send to blast
MSFGGMFDGA GSGVFSYDAA GGGGGGVHNS RLLPTPPQTM DGGQLGDVNR SLAMMGNGGS  60
GSGGDGDSLG RGREDENDSR SGSDNLDGAS GDELDPDNSN PRKKKKRYHR HTPQQIQELE  120
AVFKECPHPD EKQRMELSRR LNLESRQVKF WFQNRRTQMK TQIERHENAL LRQENDKLRA  180
ENMTIREAMR NPMCASCGGA AVLGEVSLEE QHLRIENARL KDELDRVCAL AGKFLGRPIS  240
SISSPGPPSL QACSGLELGV GSNGGFGLGA LGASAAMQSI PDLMGGSSGL TGGPVGSAAM  300
RLPAGIGGLD GAMHAAAADG GAFDRAVLLE LALAAMDELV KVAQMDEPLW LPSLDGGFET  360
LNYDEYHRAF ARVLGQCPAG YVSEATRESG IAIISSVDLV DSLMDAPRWS EMFPCVVARA  420
STTDIISSGM GGTRSGSIQL MHAELQVLSP LVPIREVVFL RFCKQHAEGL WAVVDVSVDA  480
VLRPDQNGCG GSSSSSYMGC RLLPTGCIVQ DMNNGYSKVT WVVHAEYDET AAHQLYRPLL  540
RSGQALGARR WLASLQRQCQ YLAILCSNSL PARDHAAITP VGRRSMLKLA QRMTDNFCAG  600
VCASAAQKWR RLDEWRGEGG GGGGGGGGDG EDKVRMMARH SVGAPGEPPG VVLSATTSVR  660
LPGTLPQRVF DYLRDEQRRG DWDILANGEA MQEMDHIAKG QHHGNAVSLL RPNATSGNQN  720
NMLILQETCT DSSGSLVVYA PVDVQSMHVV MNGGDSAYVS LLPSGFAILP DGHNNGASPS  780
SAEVGGGASP NSAAGGGSNN TGSLVTVAFQ ILVNNLPTAK LTVESVDTVS NLLSCTIQKI  840
KSALQASIIS P
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101106RKKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612621.10.0PREDICTED: homeobox-leucine zipper protein ROC6
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLA0A0E0EU140.0A0A0E0EU14_9ORYZ; Uncharacterized protein
STRINGLOC_Os09g35760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein